Commit 524c63f5 authored by Carsten Kemena's avatar Carsten Kemena

[AlignmentMatrix] added gop/gep return function

parent 3aa6e839
......@@ -273,6 +273,17 @@ public:
gep_ = penalty;
}
/**
* @brief Returns the current gap extension penalites
*
* @return The used gap extension pentalties.
*/
DataType
gep() const
{
return gep_;
}
/**
* \brief Sets gap opening penalties.
* @param penalty Value of the gap costs.
......@@ -283,6 +294,18 @@ public:
gop_ = penalty;
}
/**
* @brief Returns the current gap opening penalties
*
* @return The used gap openeing penalties.
*/
DataType
gop() const
{
return gop_;
}
/**
* \brief Sets the similarity Matrix.
* @param mat The matrix to use.
......
......@@ -42,6 +42,18 @@
BOOST_AUTO_TEST_SUITE(AlignementMatrix_Test)
BOOST_AUTO_TEST_CASE( general_tests)
{
BioSeqDataLib::AlignmentMatrix<float, BioSeqDataLib::SimilarityMatrix<float> > mat;
mat.gop(-0.5);
BOOST_CHECK_EQUAL(mat.gop(), -0.5);
mat.gep(-6);
BOOST_CHECK_EQUAL(mat.gep(), -6);
}
BOOST_AUTO_TEST_CASE( nw_sequence_test)
{
BioSeqDataLib::Sequence<> seq1("seq1", "LMLDSGSEPKLIAEPLXPQGPYELSDETLQAPVLNDEGTEAVFELLSNAVEV", "", "test sequence");
......
Markdown is supported
0% or
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment